PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g05380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family Whirly
Protein Properties Length: 160aa    MW: 17768.1 Da    PI: 7.6082
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g05380genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly186.15.9e-58312022139
      Whirly  22 dsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgne 120
                 +sg++kl+r+G ++l++a+a+++r+ydW++kq+f+ls+te++++++l++k+sceffhdp ++ s+eG+vrk+lkvePlpdGsG+f+nlsv+n+l++ +e
  CA11g05380   3 QSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGAKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSGHFFNLSVQNKLINLDE 101
                 69************************************************************************************************* PP

      Whirly 121 sfsvPvskaefavlrsllv 139
                 ++++Pv+kaefavl s+++
  CA11g05380 102 NIYIPVTKAEFAVLVSAFN 120
                 ***************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF085362.4E-532117IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.102.7E-643142IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544479.42E-673159IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MEQSGAFKLS REGMVMLQFA PAAGVRQYDW SRKQVFSLSV TEIGSIISLG AKDSCEFFHD  60
PNKGRSDEGR VRKVLKVEPL PDGSGHFFNL SVQNKLINLD ENIYIPVTKA EFAVLVSAFN  120
FVVPYLLGWH TAANSFKPED TSRSNNANPR SGAELEWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-111415865219p24: plant transcriptional regulator PBF-2
1l3a_B1e-111415865219p24: plant transcriptional regulator PBF-2
1l3a_C1e-111415865219p24: plant transcriptional regulator PBF-2
1l3a_D1e-111415865219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2333420.0AF233342.1 Solanum tuberosum DNA-binding protein p24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548546.11e-113PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9LL851e-113WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A0V0HSY51e-111A0A0V0HSY5_SOLCH; Putative single-stranded DNA-binding protein WHY1, chloroplastic-like
STRINGPGSC0003DMT4000454391e-111(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.18e-95ssDNA-binding transcriptional regulator